PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG006432t2
Common NameTCM_006432
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 353aa    MW: 38829.4 Da    PI: 9.0649
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG006432t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1439.8e-14271327460
                       XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                        +++rr++kNRe+A rsR+RK+a++ eLe  v +Le+e ++L  e  el+ke  k  
  Thecc1EG006432t2 271 QQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEEQTRLLREEAELQKERFKQL 327
                       689**************************************9888878877765544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.5E-13265327No hitNo description
SMARTSM003382.5E-12268332IPR004827Basic-leucine zipper domain
PfamPF001704.1E-12270329IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.392270322IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.75E-10272324No hitNo description
CDDcd147075.45E-19272321No hitNo description
PROSITE patternPS000360275290IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
TVGQRLCSSA VAFRFSNNFP SVFEFYLILS FSNQSAESQK GKEREREEIV SKKLVRERKN  60
PENSGGVMAS SKVITTTSAT NPDVPRQPSL CSSLSTLLAD LQNQQSNQSQ SQNGSMSMDD  120
LLKNIYSSPP PPPTTSEAHA QFPGASISRE GSFSLPKDVA NKSVDEVWKE IVAGGGDQRQ  180
GGPTEEMTLE DFLTKAGAVR EEDVRGVVNQ VGVGAGVYAV DPAVINGGGS QFSTFGNNGG  240
VDHQRLVAPA GGGARGKRRA VEEPPLDKAT QQKQRRMIKN RESAARSRER KQAYTVELES  300
LVTQLEEEQT RLLREEAELQ KERFKQLMEN LIPVEEKRRP PRVLRRVHSM QW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007041584.10.0Basic-leucine zipper transcription factor family protein, putative isoform 2, partial
SwissprotP427771e-43GBF4_ARATH; G-box-binding factor 4
TrEMBLA0A061DXI20.0A0A061DXI2_THECC; Basic-leucine zipper transcription factor family protein, putative isoform 2 (Fragment)
STRINGVIT_12s0055g00420.t012e-90(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16538611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.16e-31bZIP family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]